Return to main results Retrieve Phyre Job Id

Job DescriptionP42628
Confidence26.79%DateThu Jan 5 12:01:58 GMT 2012
Rank11Aligned Residues36
% Identity19%Templatec2hg5D_
PDB info PDB header:membrane proteinChain: D: PDB Molecule:kcsa channel; PDBTitle: cs+ complex of a k channel with an amide to ester substitution in the2 selectivity filter
Resolution2.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   10.........20.........30.........40.........50.........60......
Predicted Secondary structure 




















Query SS confidence 
























































Query Sequence  IADASTPAGRAGMSESEWREAIKFDSTDTGWVIMSIGMAIGAGIVFLPVQVGLMGLW
Query Conservation        
                           
  
 

 


 

      
  
Alig confidence 









.....................

























Template Conservation 

 


  

..................... 

    
 

   
  

 


 
 
Template Sequence  DLYPVTLWGR. . . . . . . . . . . . . . . . . . . . . LVAVVVMVAGITSFGLVTAALATWFV
Template Known Secondary structure 




S.....................
Template Predicted Secondary structure 





.....................
Template SS confidence 
























































   80......... 90.........100.........110.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions