Return to main results Retrieve Phyre Job Id

Job DescriptionP76518
Confidence27.03%DateThu Jan 5 12:23:58 GMT 2012
Rank294Aligned Residues45
% Identity31%Templatec3kbqA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:protein ta0487; PDBTitle: the crystal structure of the protein cina with unknown function from2 thermoplasma acidophilum
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   24.....30.........40.........50.........60.........70.........80.........90.........100
Predicted Secondary structure 































Query SS confidence 












































































Query Sequence  GPFGTQLLCNMGARVIKVEPPGHGDDTRTFGPYVDGQSLYYSFINHGKESVVLDLKNDHDKSIFINMLKQADVLAEN
Query Conservation 

 
  



 







 
  

  
            
   






 


    
   
  

  


 
 
Alig confidence 

















................................


























Template Conservation     
   
   
  
   ................................ 

 

   
   
       





Template Sequence  AAFIGNFLTYHGYQVRRG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . FVVMDDLDEIGWAFRVALEVSDLVVSS
Template Known Secondary structure  TT
................................
S

S
Template Predicted Secondary structure 



................................





Template SS confidence 












































































   22.......30......... 40.........50.........60......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions