Return to main results Retrieve Phyre Job Id

Job DescriptionP76518
Confidence37.29%DateThu Jan 5 12:23:58 GMT 2012
Rank224Aligned Residues45
% Identity16%Templatec2g4rB_
PDB info PDB header:biosynthetic proteinChain: B: PDB Molecule:molybdopterin biosynthesis mog protein; PDBTitle: anomalous substructure of moga
Resolution1.92 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   24.....30.........40.........50.........60.........70.........80.........90.........100
Predicted Secondary structure 































Query SS confidence 












































































Query Sequence  GPFGTQLLCNMGARVIKVEPPGHGDDTRTFGPYVDGQSLYYSFINHGKESVVLDLKNDHDKSIFINMLKQADVLAEN
Query Conservation 

 
  



 







 
  

  
            
   






 


    
   
  

  


 
 
Alig confidence 





















................................






















Template Conservation 
  
   
   
  
     
 ................................

   
           





Template Sequence  GPIIAGWLEQHGFSSVQPQVVA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . DGNPVGEALHDAVNAGVDVIITS
Template Known Secondary structure  TT





................................SST
S
Template Predicted Secondary structure 



................................





Template SS confidence 












































































   25....30.........40...... ...50.........60.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions