Return to main results Retrieve Phyre Job Id

Job DescriptionP76518
Confidence27.58%DateThu Jan 5 12:23:58 GMT 2012
Rank293Aligned Residues55
% Identity18%Templatec1uz5A_
PDB info PDB header:molybdopterin biosynthesisChain: A: PDB Molecule:402aa long hypothetical molybdopterin PDBTitle: the crystal structure of molybdopterin biosynthesis moea2 protein from pyrococcus horikosii
Resolution2.05 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   24.....30.........40.........50.........60.........70.........80.........90.........100
Predicted Secondary structure 































...
Query SS confidence 












































































. . .
Query Sequence  GPFGTQLLCNMGARVIKVEPPGHGDDTRTFGPYVDGQSLYYSFINHGKESVVLDLKNDHDKSIFINMLKQADVLAEN. . .
Query Conservation 

 
  



 







 
  

  
            
   






 


    
   
  

  


 
 
...
Alig confidence 





















................................






















...
Template Conservation     
 
 
   
  
     
 ................................

   
  

  
    







 
Template Sequence  GRALCDAINELGGEGIFMGVAR. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . DDKESLKALIEKAVNVGDVVVISGGA
Template Known Secondary structure  TS
................................SS
S


Template Predicted Secondary structure 




................................





Template SS confidence 















































































   209210.........220.........230 .........240.........250......
 
   101........110
Predicted Secondary structure  .



Query SS confidence  .









Query Sequence  . FRPGTMEKLG
Query Conservation  .  

    

Alig confidence  .









Template Conservation 
     
   
Template Sequence  DLTASVIEELG
Template Known Secondary structure 
S
Template Predicted Secondary structure 

Template SS confidence 










   262.......270..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions