Return to main results Retrieve Phyre Job Id

Job DescriptionP0A894
Confidence96.41%DateThu Jan 5 11:07:13 GMT 2012
Rank117Aligned Residues33
% Identity39%Templatec3pihA_
PDB info PDB header:hydrolase/dnaChain: A: PDB Molecule:uvrabc system protein a; PDBTitle: t. maritima uvra in complex with fluorescein-modified dna
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10........ .20........ .30....
Predicted Secondary structure 





..........



......



Query SS confidence 
















. . . . . . . . . .









. . . . . .





Query Sequence  VLMIVSGRSGSGKSVAL. . . . . . . . . . RALEDMGFYC. . . . . . VDNLPV
Query Conservation   












 

..........  


 

 
......




 
Alig confidence 
















..........









......





Template Conservation       

 












  

 
   
  
    
 

 
 

 
Template Sequence  RLVVITGVSGSGKSSLAMDTIYAEGQRRYLESLSTYKKPDVDEIEGLSP
Template Known Secondary structure  SSTTSSSTTTTTS





S
ST


Template Predicted Secondary structure 






















Template SS confidence 
















































   25....30.........40.........50.........60.........70...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions