Return to main results Retrieve Phyre Job Id

Job DescriptionP0A894
Confidence93.26%DateThu Jan 5 11:07:13 GMT 2012
Rank154Aligned Residues27
% Identity52%Templatec2iusB_
PDB info PDB header:membrane proteinChain: B: PDB Molecule:dna translocase ftsk; PDBTitle: e. coli ftsk motor domain
Resolution2.7 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20. ........30
Predicted Secondary structure 





..........




Query SS confidence 

















. . . . . . . . . .








Query Sequence  MIVSGRSGSGKSVALRAL. . . . . . . . . . EDMGFYCVD
Query Conservation 











 

  
..........

 

 


Alig confidence 

















..........








Template Conservation 




 





  
  

 

     
  
 
 


Template Sequence  LLVAGTTGSGASVGVNAMILSMLYKAQPEDVRFIMID
Template Known Secondary structure 

TTSSTT

TTT
Template Predicted Secondary structure 








Template SS confidence 




































   987..990.........1000.........1010.........1020...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions