Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6H5
Confidence95.32%DateThu Jan 5 11:03:09 GMT 2012
Rank457Aligned Residues35
% Identity26%Templatec4a4zA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:antiviral helicase ski2; PDBTitle: crystal structure of the s. cerevisiae dexh helicase ski2 bound to2 amppnp
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   20.........30.........40.........50.........60....... ..70....
Predicted Secondary structure 












.
Query SS confidence 















































.






Query Sequence  QDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIA. RRLAKLA
Query Conservation 
  


 

 

  
  
            
  


 







 

.



  
Alig confidence 









....................

















.






Template Conservation 
  

  
  ....................  



 







 


 

   
Template Sequence  QKEAVYHLEQ. . . . . . . . . . . . . . . . . . . . GDSVFVAAHTSAGKTVVAEYAIAMAH
Template Known Secondary structure  T....................T


TTS
S
Template Predicted Secondary structure 
....................








Template SS confidence 























































   334.....340... ......350.........360.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions