Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6H5
Confidence96.21%DateThu Jan 5 11:03:09 GMT 2012
Rank357Aligned Residues35
% Identity34%Templatec3oiyB_
PDB info PDB header:isomeraseChain: B: PDB Molecule:reverse gyrase helicase domain; PDBTitle: helicase domain of reverse gyrase from thermotoga maritima
Resolution2.35 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   20.........30.........40.........50.........60.........70....
Predicted Secondary structure 













Query SS confidence 






















































Query Sequence  QDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLA
Query Conservation 
  


 

 

  
  
            
  


 







 





  
Alig confidence 









....................
























Template Conservation 
         .................... 
  

 







          
Template Sequence  QRLWAKRIVQ. . . . . . . . . . . . . . . . . . . . GKSFTMVAPTGVGKTTFGMMTALWL
Template Known Secondary structure  TT....................T




SS
TT
Template Predicted Secondary structure 
....................







Template SS confidence 






















































   83......90.. .......100.........110.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions