Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6H5
Confidence96.18%DateThu Jan 5 11:03:09 GMT 2012
Rank359Aligned Residues42
% Identity24%Templatec2z0mA_
PDB info PDB header:rna binding proteinChain: A: PDB Molecule:337aa long hypothetical atp-dependent rna PDBTitle: crystal structure of hypothetical atp-dependent rna2 helicase from sulfolobus tokodaii
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   20.........30.........40.........50.........60.........70.........80.
Predicted Secondary structure 
















Query SS confidence 





























































Query Sequence  QDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKV
Query Conservation 
  


 

 

  
  
            
  


 







 





  
 



  
Alig confidence 









....................































Template Conservation 
  

  
  ....................    

 







       
      


Template Sequence  QSKTIPLMLQ. . . . . . . . . . . . . . . . . . . . GKNVVVRAKTGSGKTAAYAIPILELGMKSLVV
Template Known Secondary structure  T....................T



TTSST

Template Predicted Secondary structure 
....................











Template SS confidence 





























































   21........30 .........40.........50.........60..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions