Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6H5
Confidence96.60%DateThu Jan 5 11:03:09 GMT 2012
Rank321Aligned Residues42
% Identity31%Templatec2fwrA_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:dna repair protein rad25; PDBTitle: structure of archaeoglobus fulgidis xpb
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   20.........30.........40.........50.........60.........70.........80.
Predicted Secondary structure 
















Query SS confidence 





























































Query Sequence  QDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKV
Query Conservation 
  


 

 

  
  
            
  


 







 





  
 



  
Alig confidence 









....................































Template Conservation 
  
      ....................    

  






  

          


Template Sequence  QEKALERWLV. . . . . . . . . . . . . . . . . . . . DKRGCIVLPTGSGKTHVAMAAINELSTPTLIV
Template Known Secondary structure  TT....................TT

TTS

S
Template Predicted Secondary structure 
....................












Template SS confidence 





























































   98.100....... ..110.........120.........130.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions