Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6H5
Confidence96.97%DateThu Jan 5 11:03:09 GMT 2012
Rank280Aligned Residues36
% Identity25%Templatec1w36G_
PDB info PDB header:recombinationChain: G: PDB Molecule:exodeoxyribonuclease v alpha chain; PDBTitle: recbcd:dna complex
Resolution3.1 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1920.........30.........40.........50.........60.........70....
Predicted Secondary structure 














Query SS confidence 























































Query Sequence  GQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLA
Query Conservation 

  


 

 

  
  
            
  


 







 





  
Alig confidence 










....................
























Template Conservation   
  

     ....................    

 
 





  
  

  
Template Sequence  WQKVAAAVALT. . . . . . . . . . . . . . . . . . . . RRISVISGGPGTGKTTTVAKLLAAL
Template Known Secondary structure  T....................BS

TTST
Template Predicted Secondary structure  ....................






Template SS confidence 























































   153......160... ......170.........180........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions