Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6H5
Confidence95.71%DateThu Jan 5 11:03:09 GMT 2012
Rank410Aligned Residues28
% Identity32%Templatec1s2mA_
PDB info PDB header:rna binding proteinChain: A: PDB Molecule:putative atp-dependent rna helicase dhh1; PDBTitle: crystal structure of the dead box protein dhh1p
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   20.........30.........40.........50.........60.......
Predicted Secondary structure 












Query SS confidence 















































Query Sequence  QDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIA
Query Conservation 
  


 

 

  
  
            
  


 







 

Alig confidence 









....................

















Template Conservation 
  

  

 ....................   


 







   
Template Sequence  QEEAIPVAIT. . . . . . . . . . . . . . . . . . . . GRDILARAKNGTGKTAAF
Template Known Secondary structure  ....................T



TTS
Template Predicted Secondary structure 
....................








Template SS confidence 















































   73......80.. .......90.........100
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions