Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6H5
Confidence96.00%DateThu Jan 5 11:03:09 GMT 2012
Rank379Aligned Residues33
% Identity30%Templatec1hv8B_
PDB info PDB header:rna binding proteinChain: B: PDB Molecule:putative atp-dependent rna helicase mj0669; PDBTitle: crystal structure of a dead box protein from the2 hyperthermophile methanococcus jannaschii
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   20.........30.........40.........50.........60.........70.
Predicted Secondary structure 












Query SS confidence 



















































Query Sequence  QDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLA
Query Conservation 
  


 

 

  
  
            
  


 







 





Alig confidence 









...................






















Template Conservation 
  

   
 ...................    


 








   
  
Template Sequence  QXKVIPLFLN. . . . . . . . . . . . . . . . . . . DEYNIVAQARTGSGKTASFAIPL
Template Known Secondary structure  ...................T
S

SSSS
Template Predicted Secondary structure 
...................









Template SS confidence 



















































   33......40.. .......50.........60.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions