Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6H5
Confidence97.03%DateThu Jan 5 11:03:09 GMT 2012
Rank277Aligned Residues39
% Identity31%Templatec1gm5A_
PDB info PDB header:helicaseChain: A: PDB Molecule:recg; PDBTitle: structure of recg bound to three-way dna junction
Resolution3.24 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1920.........30.........40.........50.........60.........70.
Predicted Secondary structure 













Query SS confidence 




















































Query Sequence  GQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLA
Query Conservation 

  


 

 

  
  
            
  


 







 





Alig confidence 












..............

























Template Conservation   
  

 

  

..............     
 











 

 


Template Sequence  AQKRAHQEIRNDM. . . . . . . . . . . . . . ISEKPMNRLLQGDVGSGKTVVAQLAI
Template Known Secondary structure  ..............SSS





SSSS
Template Predicted Secondary structure  ..............










Template SS confidence 




















































   372.......380.... .....390.........400.........410
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions