Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9A9
Confidence25.69%DateThu Jan 5 11:09:47 GMT 2012
Rank414Aligned Residues42
% Identity17%Templatec3on4D_
PDB info PDB header:transcriptionChain: D: PDB Molecule:transcriptional regulator, tetr family; PDBTitle: crystal structure of tetr transcriptional regulator from legionella2 pneumophila
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.......
Predicted Secondary structure 



















Query SS confidence 
























































Query Sequence  MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYR
Query Conservation 
      
   
 
 
 

  

  
      
 

 

   
      

  



Alig confidence 









..........






















.....








Template Conservation     

  

 ..........

  
    
    

  

  
.....


  


 
Template Sequence  ISNTKERILA. . . . . . . . . . VAEALIQKDGYNAFSFKDIATAI. . . . . NIKTASIHY
Template Known Secondary structure 


..........
GGG

.....T

Template Predicted Secondary structure  ..........





.....


Template SS confidence 
























































   5....10.... .....20.........30....... ..40......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions