Return to main results Retrieve Phyre Job Id

Job DescriptionQ47684
Confidence14.24%DateThu Jan 5 12:37:00 GMT 2012
Rank19Aligned Residues25
% Identity32%Templatec3aqoD_
PDB info PDB header:membrane proteinChain: D: PDB Molecule:probable secdf protein-export membrane protein; PDBTitle: structure and function of a membrane component secdf that enhances2 protein export
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   33......40.........50.........60........
Predicted Secondary structure 










Query SS confidence 



































Query Sequence  RASITGKFSDIECRKLDETFPHFILQMESMLTTGEL
Query Conservation 



 
 

      






 




 

 



Alig confidence 












...........











Template Conservation     


 

  

...........  

  





Template Sequence  QAVIEGLSSVEEA. . . . . . . . . . . SEIALVLRSGSL
Template Known Secondary structure 


S
...........


Template Predicted Secondary structure 




...........



Template SS confidence 



































   226...230........ .240.........250
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions