Return to main results Retrieve Phyre Job Id

Job DescriptionA5A607
Confidence9.27%DateThu Jan 5 10:55:15 GMT 2012
Rank16Aligned Residues35
% Identity11%Templated1qu3a1
SCOP infoAnticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases
Resolution2.90

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1920.........30.. .......40.........50...
Predicted Secondary structure 
............






Query SS confidence 













. . . . . . . . . . . .




















Query Sequence  NQMIEQINIALEQK. . . . . . . . . . . . GSGNFSAWVIEACRRRLTSEK
Query Conservation    





    

............   





 



 

   
Alig confidence 













............




















Template Conservation        
      
 
  
   
  
   


  


  
 


   
Template Sequence  REFTASTINNYENFDYLNIYQEVQNFINVELSNFYLDYGKDILYIEQ
Template Known Secondary structure  TT

TTTTTTTS
Template Predicted Secondary structure 










Template SS confidence 














































   686...690.........700.........710.........720.........730..
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions