Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABU5
Confidence25.44%DateThu Jan 5 11:16:24 GMT 2012
Rank231Aligned Residues34
% Identity12%Templatec3u1tA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:dmma haloalkane dehalogenase; PDBTitle: haloalkane dehalogenase, dmma, of marine microbial origin
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   88.90... ......100.........110.........120.........130...
Predicted Secondary structure 

.














Query SS confidence 





.







































Query Sequence  ALIVPG. GFGAAKNLSNFASLGSECTVDRELKALAQAMHQAGKPLGF
Query Conservation 





.
 
    
            
  
  

       
 


Alig confidence 





.








............


















Template Conservation     
   

    
 
............  
   
  

    
 

Template Sequence  VRFVGAGTHFLQEDHP. . . . . . . . . . . . HLIGQGIADWLRRNKPHAS
Template Known Secondary structure  SS

............




Template Predicted Secondary structure 






............





Template SS confidence 














































   307..310.........320.. .......330.........340.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions