Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABU5
Confidence34.08%DateThu Jan 5 11:16:24 GMT 2012
Rank192Aligned Residues31
% Identity23%Templatec3n53B_
PDB info PDB header:transcriptionChain: B: PDB Molecule:response regulator receiver modulated diguanylate cyclase; PDBTitle: crystal structure of a response regulator receiver modulated2 diguanylate cyclase from pelobacter carbinolicus
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40
Predicted Secondary structure 











Query SS confidence 







































Query Sequence  MKKIGVILSGCGVYDGSEIHEAVLTLLAISRSGAQAVCFA
Query Conservation 









 
  

 
  
   
   
 


  
   
Alig confidence 






.......
..






















Template Conservation 
  



.......
..

      
   
     
  
 
Template Sequence  LKKILII. . . . . . . D. . QQDFSRIELKNFLDSEYLVIESK
Template Known Secondary structure 

.......
..S
TTTSS
Template Predicted Secondary structure 

.......
..









Template SS confidence 







































   1...... . .10.........20.........30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions