Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABU5
Confidence29.79%DateThu Jan 5 11:16:24 GMT 2012
Rank213Aligned Residues38
% Identity26%Templatec3bq9A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:predicted rossmann fold nucleotide-binding domain- PDBTitle: crystal structure of predicted nucleotide-binding protein from2 idiomarina baltica os145
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   88.90.........100.........110.........120.........130........
Predicted Secondary structure 


















Query SS confidence 


















































Query Sequence  ALIVPGGFGAAKNLSNFASLGSECTVDRELKALAQAMHQAGKPLGFMCIAP
Query Conservation 






 
    
            
  
  

       
 




 

Alig confidence 















.............





















Template Conservation 















.............





  
 
  





 

Template Sequence  IVIFPGGAGTAEELLY. . . . . . . . . . . . . LLGILMHPDNQRQSLPVILTGP
Template Known Secondary structure 
S
S.............TSGGGTT




Template Predicted Secondary structure 





.............










Template SS confidence 


















































   248.250.........260... ......270.........280.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions