Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABU5
Confidence96.32%DateThu Jan 5 11:16:24 GMT 2012
Rank70Aligned Residues44
% Identity30%Templatec2w7tA_
PDB info PDB header:ligaseChain: A: PDB Molecule:putative cytidine triphosphate synthase; PDBTitle: trypanosoma brucei ctps - glutaminase domain with bound2 acivicin
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   84.....90.........100.........110.........120.........130.........140..
Predicted Secondary structure 




















Query SS confidence 


























































Query Sequence  AELDALIVPGGFGAAKNLSNFASLGSECTVDRELKALAQAMHQAGKPLGFMCIAPAMLP
Query Conservation   









 
    
            
  
  

       
 




 

  

Alig confidence 













..............























.





Template Conservation     







 
 ..............         
  
 
   





.
 
 
 
Template Sequence  LGCDGIFVPGGFGN. . . . . . . . . . . . . . RGVDGKCAAAQVARMNNIPYFGVL. GMQVAV
Template Known Secondary structure  T
S



TT..............TTT



.
Template Predicted Secondary structure 







..............









.
Template SS confidence 


























































   382.......390..... ....400.........410......... 420.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions