Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABU5
Confidence24.54%DateThu Jan 5 11:16:24 GMT 2012
Rank234Aligned Residues42
% Identity17%Templatec2higA_
PDB info PDB header:transferaseChain: A: PDB Molecule:6-phospho-1-fructokinase; PDBTitle: crystal structure of phosphofructokinase apoenzyme from trypanosoma2 brucei.
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   78.80.........90.........100.........110.........120.........130.....
Predicted Secondary structure 





















Query SS confidence 

























































Query Sequence  LAQADAAELDALIVPGGFGAAKNLSNFASLGSECTVDRELKALAQAMHQAGKPLGFMC
Query Conservation 
  
   









 
    
            
  
  

       
 




Alig confidence 






















................


















Template Conservation     
    
  

 





   ................
  
          
 


Template Sequence  VDTLERLGVNILFTVGGDGTQRG. . . . . . . . . . . . . . . . ALVISQEAKRRGVDISVFG
Template Known Secondary structure  T
S
................T


Template Predicted Secondary structure 





................




Template SS confidence 

























































   182.......190.........200.... .....210.........220...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions