Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABU5
Confidence22.34%DateThu Jan 5 11:16:24 GMT 2012
Rank249Aligned Residues28
% Identity21%Templatec1rcuB_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:conserved hypothetical protein vt76; PDBTitle: x-ray structure of tm1055 northeast structural genomics2 consortium target vt76
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   88.90.........100.........110.........120.........130.....
Predicted Secondary structure 

















Query SS confidence 















































Query Sequence  ALIVPGGFGAAKNLSNFASLGSECTVDRELKALAQAMHQAGKPLGFMC
Query Conservation 






 
    
            
  
  

       
 




Alig confidence 









....................

















Template Conservation   





 

....................
 
   
    


  
 
Template Sequence  VVSIGGEIGT. . . . . . . . . . . . . . . . . . . . AIEILGAYALGKPVILLR
Template Known Secondary structure  S

....................T

T
Template Predicted Secondary structure 



....................

Template SS confidence 















































   100......... 110.........120.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions