Return to main results Retrieve Phyre Job Id

Job DescriptionP33596
Confidence33.10%DateThu Jan 5 11:52:21 GMT 2012
Rank86Aligned Residues40
% Identity18%Templatec3s2wB_
PDB info PDB header:transcription regulatorChain: B: PDB Molecule:transcriptional regulator, marr family; PDBTitle: the crystal structure of a marr transcriptional regulator from2 methanosarcina mazei go1
Resolution2.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20.. .......30.........40.........50.........60.........
Predicted Secondary structure  .
















Query SS confidence 





.














































Query Sequence  RAVRIL. AVRDHSEQELRRKLAAPIMGKNGPEEIDATAEDYERVIAWCHEHGYL
Query Conservation   

  
.  
  
  

  

  
                
  

  
 
 


Alig confidence 





.













.............



















Template Conservation   

  
      
  


  
............. 
   


  
  

  
 
Template Sequence  PFLXRLYREDGINQESLSDYL. . . . . . . . . . . . . KIDKGTTARAIQKLVDEGYV
Template Known Secondary structure  SSS.............T

TTS
Template Predicted Secondary structure 




.............





Template SS confidence 





















































   51........60.........70. ........80.........90.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions