Return to main results Retrieve Phyre Job Id

Job DescriptionP33596
Confidence39.34%DateThu Jan 5 11:52:21 GMT 2012
Rank58Aligned Residues40
% Identity8%Templatec3oopA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:lin2960 protein; PDBTitle: the structure of a protein with unknown function from listeria innocua2 clip11262
Resolution1.78 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20....... ..30.........40.........50.........60.........
Predicted Secondary structure 

.














Query SS confidence 










.









































Query Sequence  RAVRILAVRDH. SEQELRRKLAAPIMGKNGPEEIDATAEDYERVIAWCHEHGYL
Query Conservation   

  
  
  .
  

  

  
                
  

  
 
 


Alig confidence 










.








.............



















Template Conservation   

  
      
  


   .............      

  
  
   


Template Sequence  SVLEGIEANEPISQKEIALWT. . . . . . . . . . . . . KKDTPTVNRIVDVLLRKELI
Template Known Secondary structure  SS.............T

TTS
Template Predicted Secondary structure 




.............








Template SS confidence 





















































   38.40.........50........ .60.........70........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions