Return to main results Retrieve Phyre Job Id

Job DescriptionP33596
Confidence62.52%DateThu Jan 5 11:52:21 GMT 2012
Rank9Aligned Residues40
% Identity10%Templatec3f3xA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:transcriptional regulator, marr family, putative; PDBTitle: crystal structure of the transcriptional regulator bldr2 from sulfolobus solfataricus
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20.........30.........40.........50.........60.........
Predicted Secondary structure 
















Query SS confidence 




















































Query Sequence  RAVRILAVRDHSEQELRRKLAAPIMGKNGPEEIDATAEDYERVIAWCHEHGYL
Query Conservation   

  
  
  
  

  

  
                
  

  
 
 


Alig confidence 



















.............



















Template Conservation   

  
     
  


   .............    
 

  
  
   
 
Template Sequence  SILKATSEEPRSMVYLANRY. . . . . . . . . . . . . FVTQSAITAAVDKLEAKGLV
Template Known Secondary structure  S
.............T

TTS
Template Predicted Secondary structure 




.............







Template SS confidence 




















































   41........50.........60 .........70.........80
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions