Return to main results Retrieve Phyre Job Id

Job DescriptionP33596
Confidence37.49%DateThu Jan 5 11:52:21 GMT 2012
Rank65Aligned Residues40
% Identity25%Templatec3cjnA_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:transcriptional regulator, marr family; PDBTitle: crystal structure of transcriptional regulator, marr family, from2 silicibacter pomeroyi
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20....... ..30.........40.........50.........60.........
Predicted Secondary structure 

.














Query SS confidence 










.









































Query Sequence  RAVRILAVRDH. SEQELRRKLAAPIMGKNGPEEIDATAEDYERVIAWCHEHGYL
Query Conservation   

  
  
  .
  

  

  
                
  

  
 
 


Alig confidence 










.








.............



















Template Conservation   

  
      
  


  
............. 
    

  
  
   
 
Template Sequence  RALAILSAKDGLPIGTLGIFA. . . . . . . . . . . . . VVEQSTLSRALDGLQADGLV
Template Known Secondary structure  S
S.............T

TTS
Template Predicted Secondary structure 




.............





Template SS confidence 





















































   53......60.........70... ......80.........90...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions