Return to main results Retrieve Phyre Job Id

Job DescriptionP33596
Confidence28.78%DateThu Jan 5 11:52:21 GMT 2012
Rank112Aligned Residues40
% Identity13%Templatec3bpxB_
PDB info PDB header:transcription regulatorChain: B: PDB Molecule:transcriptional regulator; PDBTitle: crystal structure of marr
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20.... .....30.........40.........50.........60.........
Predicted Secondary structure 
.















Query SS confidence 







.












































Query Sequence  RAVRILAV. RDHSEQELRRKLAAPIMGKNGPEEIDATAEDYERVIAWCHEHGYL
Query Conservation   

  
  .
  
  

  

  
                
  

  
 
 


Alig confidence 







.











.............



















Template Conservation   

  
      
  


  
.............      

  
  
   
 
Template Sequence  ACLLRIHREPGIKQDELATFF. . . . . . . . . . . . . HVDKGTIARTLRRLEESGFI
Template Known Secondary structure  STT
B.............T

TTS
Template Predicted Secondary structure 




.............


Template SS confidence 





















































   37..40.........50....... ..60.........70.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions