Return to main results Retrieve Phyre Job Id

Job DescriptionP33596
Confidence37.44%DateThu Jan 5 11:52:21 GMT 2012
Rank66Aligned Residues40
% Identity18%Templatec3bddD_
PDB info PDB header:transcriptionChain: D: PDB Molecule:regulatory protein marr; PDBTitle: crystal structure of a putative multiple antibiotic-resistance2 repressor (ssu05_1136) from streptococcus suis 89/1591 at 2.20 a3 resolution
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20... ......30.........40.........50.........60.........
Predicted Secondary structure  .
















Query SS confidence 






.













































Query Sequence  RAVRILA. VRDHSEQELRRKLAAPIMGKNGPEEIDATAEDYERVIAWCHEHGYL
Query Conservation   

  
 . 
  
  

  

  
                
  

  
 
 


Alig confidence 






.












.............



















Template Conservation   

  
      
  


   .............     


  
  

  


Template Sequence  SILQTLLKDAPLHQLALQERL. . . . . . . . . . . . . QIDRAAVTRHLKLLEESGYI
Template Known Secondary structure 
S.............T

TTS
Template Predicted Secondary structure 




.............


Template SS confidence 





















































   34.....40.........50.... .....60.........70....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions