Return to main results Retrieve Phyre Job Id

Job DescriptionP33596
Confidence58.60%DateThu Jan 5 11:52:21 GMT 2012
Rank15Aligned Residues40
% Identity13%Templatec2qwwB_
PDB info PDB header:transcriptionChain: B: PDB Molecule:transcriptional regulator, marr family; PDBTitle: crystal structure of multiple antibiotic-resistance repressor (marr)2 (yp_013417.1) from listeria monocytogenes 4b f2365 at 2.07 a3 resolution
Resolution2.07 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20....... ..30.........40.........50.........60.........
Predicted Secondary structure 

.














Query SS confidence 










.









































Query Sequence  RAVRILAVRDH. SEQELRRKLAAPIMGKNGPEEIDATAEDYERVIAWCHEHGYL
Query Conservation   

  
  
  .
  

  

  
                
  

  
 
 


Alig confidence 










.








.............



















Template Conservation    
  
      
   

  
............. 
   


  
  
  

 
Template Sequence  AXINVIYSTPGISVADLTKRL. . . . . . . . . . . . . IITGSSAAANVDGLISLGLV
Template Known Secondary structure  STT.............T

TTS
Template Predicted Secondary structure 




.............




Template SS confidence 





















































   44.....50.........60.... .....70.........80....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions