Return to main results Retrieve Phyre Job Id

Job DescriptionP33596
Confidence21.94%DateThu Jan 5 11:52:21 GMT 2012
Rank138Aligned Residues40
% Identity10%Templatec2p8tA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein ph0730; PDBTitle: hypothetical protein ph0730 from pyrococcus horikoshii ot3
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   18.20.........30.........40.........50.........60.........70
Predicted Secondary structure 

















Query SS confidence 




















































Query Sequence  AVRILAVRDHSEQELRRKLAAPIMGKNGPEEIDATAEDYERVIAWCHEHGYLD
Query Conservation 

  
  
  
  

  

  
                
  

  
 
 



Alig confidence 


















.............




















Template Conservation 
 
 

  




 

  
............. 



 


 
  

  


 
Template Sequence  AVIFLLKEPLGRKQISERL. . . . . . . . . . . . . ELGEGSVRTLLRKLSHLDIIR
Template Known Secondary structure  TTS
B
.............T

TTS
Template Predicted Secondary structure 






.............





Template SS confidence 




















































   22.......30.........40 .........50.........60.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions