Return to main results Retrieve Phyre Job Id

Job DescriptionP33596
Confidence25.38%DateThu Jan 5 11:52:21 GMT 2012
Rank121Aligned Residues40
% Identity15%Templatec2nyxB_
PDB info PDB header:transcriptionChain: B: PDB Molecule:probable transcriptional regulatory protein, rv1404; PDBTitle: crystal structure of rv1404 from mycobacterium tuberculosis
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20..... ....30.........40.........50.........60.........
Predicted Secondary structure 

.














Query SS confidence 








.











































Query Sequence  RAVRILAVR. DHSEQELRRKLAAPIMGKNGPEEIDATAEDYERVIAWCHEHGYL
Query Conservation   

  
  
.  
  

  

  
                
  

  
 
 


Alig confidence 








.










.............



















Template Conservation   

  
          

  
............. 
    

  
  
   


Template Sequence  RTLVILSNHGPINLATLATLL. . . . . . . . . . . . . GVQPSATGRXVDRLVGAELI
Template Known Secondary structure 
S.............TS
TTS
Template Predicted Secondary structure 




.............


Template SS confidence 





















































   4950.........60......... 70.........80.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions