Return to main results Retrieve Phyre Job Id

Job DescriptionP33596
Confidence43.04%DateThu Jan 5 11:52:21 GMT 2012
Rank40Aligned Residues38
% Identity18%Templatec2hoeA_
PDB info PDB header:transferaseChain: A: PDB Molecule:n-acetylglucosamine kinase; PDBTitle: crystal structure of n-acetylglucosamine kinase (tm1224) from2 thermotoga maritima at 2.46 a resolution
Resolution2.46 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1920.........30.........40.........50.........60.........
Predicted Secondary structure 
















Query SS confidence 


















































Query Sequence  VRILAVRDHSEQELRRKLAAPIMGKNGPEEIDATAEDYERVIAWCHEHGYL
Query Conservation 
  
  
  
  

  

  
                
  

  
 
 


Alig confidence 

















.............



















Template Conservation 
  
   



  

   ............. 

  


 
   
   


Template Sequence  LKRIXKSPVSRVELAEEL. . . . . . . . . . . . . GLTKTTVGEIAKIFLEKGIV
Template Known Secondary structure  S
B
.............T

TS
Template Predicted Secondary structure 




.............





Template SS confidence 


















































   14.....20.........30. ........40.........50.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions