Return to main results Retrieve Phyre Job Id

Job DescriptionP33596
Confidence60.53%DateThu Jan 5 11:52:21 GMT 2012
Rank12Aligned Residues40
% Identity13%Templatec2gxgA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:146aa long hypothetical transcriptional regulator; PDBTitle: crystal structure of emrr homolog from hyperthermophilic archaea2 sulfolobus tokodaii strain7
Resolution1.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20.........30.........40.........50.........60.........
Predicted Secondary structure 
















Query SS confidence 




















































Query Sequence  RAVRILAVRDHSEQELRRKLAAPIMGKNGPEEIDATAEDYERVIAWCHEHGYL
Query Conservation   

  
  
  
  

  

  
                
  

  
 
 


Alig confidence 



















.............



















Template Conservation   

  
     
  


   ............. 

   

  
  
   
 
Template Sequence  LVLRATSDGPKTMAYLANRY. . . . . . . . . . . . . FVTQSAITASVDKLEEMGLV
Template Known Secondary structure  TTS
B
T.............T

TTS
Template Predicted Secondary structure 




.............


Template SS confidence 




















































   41........50.........60 .........70.........80
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions