Return to main results Retrieve Phyre Job Id

Job DescriptionP33596
Confidence21.55%DateThu Jan 5 11:52:21 GMT 2012
Rank141Aligned Residues29
% Identity28%Templatec2fxaB_
PDB info PDB header:transcriptionChain: B: PDB Molecule:protease production regulatory protein hpr; PDBTitle: structure of the protease production regulatory protein hpr from2 bacillus subtilis.
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   28.30.........40.........50.........60.........
Predicted Secondary structure 














Query SS confidence 









































Query Sequence  SEQELRRKLAAPIMGKNGPEEIDATAEDYERVIAWCHEHGYL
Query Conservation 
  

  

  
                
  

  
 
 


Alig confidence 








.............



















Template Conservation 
 



   ............. 

  


  
  

  


Template Sequence  SISEIAKFG. . . . . . . . . . . . . VXHVSTAFNFSKKLEERGYL
Template Known Secondary structure  .............TS
TS
Template Predicted Secondary structure 
.............


Template SS confidence 









































   62.......70 .........80.........90
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions