Return to main results Retrieve Phyre Job Id

Job DescriptionP33596
Confidence29.02%DateThu Jan 5 11:52:21 GMT 2012
Rank110Aligned Residues29
% Identity10%Templatec1f5tA_
PDB info PDB header:transcription/dnaChain: A: PDB Molecule:diphtheria toxin repressor; PDBTitle: diphtheria tox repressor (c102d mutant) complexed with2 nickel and dtxr consensus binding sequence
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   28.30.........40.........50.........60.........
Predicted Secondary structure 














Query SS confidence 









































Query Sequence  SEQELRRKLAAPIMGKNGPEEIDATAEDYERVIAWCHEHGYL
Query Conservation 
  

  

  
                
  

  
 
 


Alig confidence 








.............



















Template Conservation      

  
............. 

  


  
  
   


Template Sequence  LRARIAERL. . . . . . . . . . . . . EQSGPTVSQTVARMERDGLV
Template Known Secondary structure  B.............T

TTS
Template Predicted Secondary structure 
.............








Template SS confidence 









































   1026...1030.... .....1040.........1050....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions