Return to main results Retrieve Phyre Job Id

Job DescriptionQ57049
Confidence0.70%DateThu Jan 5 12:37:12 GMT 2012
Rank85Aligned Residues22
% Identity18%Templatec2ig3A_
PDB info PDB header:oxygen storage/transportChain: A: PDB Molecule:group iii truncated haemoglobin; PDBTitle: crystal structure of group iii truncated hemoglobin from campylobacter2 jejuni
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   37..40....... ..50........
Predicted Secondary structure 


................

Query SS confidence 










. . . . . . . . . . . . . . . .










Query Sequence  FSDPTVNSLFS. . . . . . . . . . . . . . . . HTEAFSQFFGG
Query Conservation 










................










Alig confidence 










................










Template Conservation    
  
 
 
         
          
    


Template Sequence  RKDKDLGPIFNNAIGTSDEEWKEHKAKIGNFWAGMLLG
Template Known Secondary structure 
TT
SSTS
Template Predicted Secondary structure 









Template SS confidence 





































   23......30.........40.........50.........60
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions