Return to main results Retrieve Phyre Job Id

Job DescriptionQ57049
Confidence0.93%DateThu Jan 5 12:37:12 GMT 2012
Rank55Aligned Residues22
% Identity36%Templatec1dlyA_
PDB info PDB header:oxygen storage/transportChain: A: PDB Molecule:hemoglobin; PDBTitle: x-ray crystal structure of hemoglobin from the green2 unicellular alga chlamydomonas eugametos
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   37..40........ .50........
Predicted Secondary structure 


..........

Query SS confidence 











. . . . . . . . . .









Query Sequence  FSDPTVNSLFSH. . . . . . . . . . TEAFSQFFGG
Query Conservation 











..........









Alig confidence 











..........









Template Conservation    
  
   
   
          

    

Template Sequence  VADPTVSTYFSNTDMKVQRSKQFAFLAYALGG
Template Known Secondary structure  T
TTTGGGGTTS
TTS
Template Predicted Secondary structure 






Template SS confidence 































   24.....30.........40.........50.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions