Return to main results Retrieve Phyre Job Id

Job DescriptionP67601
Confidence2.87%DateThu Jan 5 12:10:40 GMT 2012
Rank83Aligned Residues22
% Identity32%Templatec2hqlB_
PDB info PDB header:dna binding proteinChain: B: PDB Molecule:hypothetical protein mg376 homolog; PDBTitle: crystal structure of a small single-stranded dna binding2 protein from mycoplasma pneumoniae
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   87..90.........100.........110......
Predicted Secondary structure 







Query SS confidence 





























Query Sequence  IRVPKIIFKQKGFFFANVWIEYSRIKAMNL
Query Conservation 

 


 

  


  


  
  
  


Alig confidence 















........





Template Conservation 


  

 







........


 
 
Template Sequence  IESSCWSVKKTGFLVT. . . . . . . . IKQMRF
Template Known Secondary structure 
TTSS........
Template Predicted Secondary structure 




........
Template SS confidence 





























   11........20...... ...30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions