Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9M0
Confidence92.65%DateThu Jan 5 11:10:41 GMT 2012
Rank492Aligned Residues35
% Identity37%Templatec4a2iV_
PDB info PDB header:ribosome/hydrolaseChain: V: PDB Molecule:putative ribosome biogenesis gtpase rsga; PDBTitle: cryo-electron microscopy structure of the 30s subunit in complex with2 the yjeq biogenesis factor
Resolution16.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   322.......330.........340.........350.........360.........
Predicted Secondary structure 















Query SS confidence 















































Query Sequence  TDHYGLERVKDRILEYLAVQSRVNKIKGPILCLVGPPGVGKTSLGQSI
Query Conservation      
    
  
 
                

 







 

  
Alig confidence 












.............





















Template Conservation    
 

  
   
.............        
 









 
Template Sequence  HTQDGLKPLEEAL. . . . . . . . . . . . . TGRISIFAGQSGVGKSSLLNAL
Template Known Secondary structure  TTTBT.............TTS

TTSS
Template Predicted Secondary structure 




.............









Template SS confidence 















































   201........210... ......220.........230.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions