Return to main results Retrieve Phyre Job Id

Job DescriptionP27303
Confidence22.02%DateThu Jan 5 11:43:50 GMT 2012
Rank126Aligned Residues41
% Identity29%Templatec1qfjD_
PDB info PDB header:oxidoreductaseChain: D: PDB Molecule:protein (flavin reductase); PDBTitle: crystal structure of nad(p)h:flavin oxidoreductase from escherichia2 coli
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   283......290.........300.........310.........320.........330.........340......
Predicted Secondary structure 


































Query SS confidence 































































Query Sequence  VKYTGKVVGLDMGTGSAFSLLPAQNATGNWIKVVQRLPVRIELDQKQLEQYPLRIGLSTLVSVN
Query Conservation      
 
  
 
                          
 
 
         
 


 
 
 
 
Alig confidence 
















...................











....











Template Conservation      
 
  
   
 
 ...................  
 
       ....  


 
 
   
Template Sequence  TTLSCKVTSVEAITDTV. . . . . . . . . . . . . . . . . . . YRVRIVPDAAFS. . . . FRAGQYLMVVMD
Template Known Secondary structure 

SSS
...................SS


....

TT
Template Predicted Secondary structure 





...................





....





Template SS confidence 































































   1........10....... ..20......... 30.........40.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions