Return to main results Retrieve Phyre Job Id

Job DescriptionP39263
Confidence5.67%DateThu Jan 5 11:58:35 GMT 2012
Rank16Aligned Residues28
% Identity29%Templatec2voyB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:sarcoplasmic/endoplasmic reticulum calcium PDBTitle: cryoem model of copa, the copper transporting atpase from2 archaeoglobus fulgidus
Resolution17.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10... ......20.........30..
Predicted Secondary structure 








........



Query SS confidence 








. . . . . . . .


















Query Sequence  TESKPTRRW. . . . . . . . AMPDTLVIIFFVAILTSLA
Query Conservation         
 ........  
    
          
Alig confidence 








........


















Template Conservation 
 
      
     
 

 
  
 

  

 

  
Template Sequence  NELPAEEGKSLWELVIEQFEDLLVRILLLAACISFV
Template Known Secondary structure  SS






SSTTS
Template Predicted Secondary structure 









Template SS confidence 



































   3940.........50.........60.........70....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions