Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8N5
Confidence95.30%DateThu Jan 5 11:08:20 GMT 2012
Rank106Aligned Residues58
% Identity22%Templatec3rf1B_
PDB info PDB header:ligaseChain: B: PDB Molecule:glycyl-trna synthetase alpha subunit; PDBTitle: the crystal structure of glycyl-trna synthetase subunit alpha from2 campylobacter jejuni subsp. jejuni nctc 11168
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   413......420.........430.........440.........450.........460.........470.........480.........490..
Predicted Secondary structure 


























Query SS confidence 















































































Query Sequence  RFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTI
Query Conservation   


 
 
 

  
  
  
   
   
            
       

 

  
 




 










 
   
Alig confidence 













............










...................























Template Conservation    

  




   ............

 
      
...................    








    


    
Template Sequence  GWEVWLDGXEVTQF. . . . . . . . . . . . TYFQQVGGIAV. . . . . . . . . . . . . . . . . . . DLVSAEITYGLERIAXYLQNVDNV
Template Known Secondary structure  TT............TT
...................SS

T
SSS
Template Predicted Secondary structure 

............



...................











Template SS confidence 















































































   126...130......... 140.........150 .........160.........170....
 
   493......500.
Predicted Secondary structure 





Query SS confidence 








Query Sequence  RDVILFPAM
Query Conservation 



 

  
Alig confidence 








Template Conservation 

      
Template Sequence  YDIVWSEFN
Template Known Secondary structure  TTST
Template Predicted Secondary structure 


Template SS confidence 








   175....180...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions