Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8N5
Confidence53.59%DateThu Jan 5 11:08:20 GMT 2012
Rank133Aligned Residues40
% Identity18%Templatec3e0dA_
PDB info PDB header:transferase/dnaChain: A: PDB Molecule:dna polymerase iii subunit alpha; PDBTitle: insights into the replisome from the crystral structure of2 the ternary complex of the eubacterial dna polymerase iii3 alpha-subunit
Resolution4.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   64.....70.........80.........90.........100.........110.........120........
Predicted Secondary structure 





















Query SS confidence 
































































Query Sequence  LNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTL
Query Conservation      
 
 
 
   
  


 

 


  
 


                  
  
  
 
 
 
Alig confidence 













.......















..................









Template Conservation      
 
 
 
   .......
 



 

  


  ..................     
 
 
Template Sequence  GKPKVLLSGMVEEV. . . . . . . RFTLSDETGALEVVKE. . . . . . . . . . . . . . . . . . DIPLLVLAEV
Template Known Secondary structure  SS



.......
TT

T..................T
Template Predicted Secondary structure 


.......


..................

Template SS confidence 
































































   1041........1050.... .....1060.........1070 .........1080
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions