Return to main results Retrieve Phyre Job Id

Job DescriptionP76641
Confidence24.28%DateThu Jan 5 12:25:13 GMT 2012
Rank181Aligned Residues35
% Identity20%Templatec3ohgA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein from duf2233 family; PDBTitle: crystal structure of a protein with unknown function from duf22332 family (bacova_00430) from bacteroides ovatus at 1.80 a resolution
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........
Predicted Secondary structure 

























Query SS confidence 
















































Query Sequence  MMSGEHTLKAVRGSFIDVTRTIDNPEEIASALRFIEDGLLLIKQGKVEW
Query Conservation                                   

 

 
 
 

 
  
Alig confidence 
























..............









Template Conservation   
    









   

 
 
..............  
 

 

 
Template Sequence  EANGKTVWLGVNGDYYADNPRRVXG. . . . . . . . . . . . . . LFYKDGVCIN
Template Known Secondary structure  TT




TTTTSS..............
TT
Template Predicted Secondary structure 














..............


Template SS confidence 
















































   119120.........130.........140... ......150...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions