Return to main results Retrieve Phyre Job Id

Job DescriptionP76641
Confidence34.09%DateThu Jan 5 12:25:13 GMT 2012
Rank175Aligned Residues20
% Identity40%Templatec3isyA_
PDB info PDB header:protein bindingChain: A: PDB Molecule:intracellular proteinase inhibitor; PDBTitle: crystal structure of an intracellular proteinase inhibitor (ipi,2 bsu11130) from bacillus subtilis at 2.61 a resolution
Resolution2.61 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   383......390.........400.........410.........420.........430.........
Predicted Secondary structure 

































Query SS confidence 
























































Query Sequence  GKEADFVVMEPTATPLQQLRYDNSVSLVDKLFVMMTLGDDRSIYRTYVDGRLVYERN
Query Conservation 
  




 
                                
  


 
  
    
Alig confidence 









.....................................









Template Conservation 

  

 
 
.....................................  
  
  

Template Sequence  GQKFELVVYD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . SEHKERYRYS
Template Known Secondary structure  S


.....................................TT

TT
Template Predicted Secondary structure 


.....................................




Template SS confidence 
























































   40......... 50.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions