Return to main results Retrieve Phyre Job Id

Job DescriptionP0AEF0
Confidence95.82%DateThu Jan 5 11:23:10 GMT 2012
Rank454Aligned Residues31
% Identity35%Templatec1yj5B_
PDB info PDB header:transferaseChain: B: PDB Molecule:5' polynucleotide kinase-3' phosphatase catalytic domain; PDBTitle: molecular architecture of mammalian polynucleotide kinase, a dna2 repair enzyme
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   102.......110......... 120.........130..
Predicted Secondary structure 




.......................



Query SS confidence 

















. . . . . . . . . . . . . . . . . . . . . . .












Query Sequence  FIFSGKPGTGKNHLAAAI. . . . . . . . . . . . . . . . . . . . . . . CNELLLRGKSVLI
Query Conservation 
 
 
  
 





 

.......................   
   
  
  
Alig confidence 

















.......................












Template Conservation 




 






 
           

 
 

           

  
  


Template Sequence  VVAVGFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQRCVSSCQAALRQGKRVVI
Template Known Secondary structure 

TTSSTGGGT


STT

Template Predicted Secondary structure 













Template SS confidence 





















































   367..370.........380.........390.........400.........410.........420
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions