Return to main results Retrieve Phyre Job Id

Job DescriptionP38036
Confidence87.34%DateThu Jan 5 11:57:49 GMT 2012
Rank451Aligned Residues37
% Identity22%Templated2pjqa1
SCOP infoHD-domain/PDEase-like HD-domain/PDEase-like HD domain
Resolution2.80

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   28.30.........40.........50.........60.........70.........
Predicted Secondary structure 










Query SS confidence 



















































Query Sequence  IYHCLDVAAVADCWWDQSVVLQNTFCRNEMLSKQRVKAWLLFFIALHDIGKF
Query Conservation    

 


  
  
                             
 


 

 
Alig confidence 











...........









....














Template Conservation    

 

   
 ........... 

  
  
 .... 

  






 
 
Template Sequence  RDHLQRVNRLAR. . . . . . . . . . . RLAKDEGANL. . . . NLTLAAAWLHDVIDA
Template Known Secondary structure  ...........T

....

Template Predicted Secondary structure  ...........



....



Template SS confidence 



















































   27..30........ .40........ .50.........60...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions