Return to main results Retrieve Phyre Job Id

Job DescriptionP38036
Confidence91.51%DateThu Jan 5 11:57:49 GMT 2012
Rank358Aligned Residues35
% Identity31%Templated2ibna1
SCOP infoHD-domain/PDEase-like HD-domain/PDEase-like MioX-like
Resolution1.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   26...30.........40.........50.........60.........70.........
Predicted Secondary structure 











Query SS confidence 





















































Query Sequence  LLIYHCLDVAAVADCWWDQSVVLQNTFCRNEMLSKQRVKAWLLFFIALHDIGKF
Query Conservation   
  

 


  
  
                             
 


 

 
Alig confidence 













...............





....














Template Conservation 
   
 







...............      ....

 

 








Template Sequence  PNSFHAFQTAEGIR. . . . . . . . . . . . . . . KAHPDK. . . . DWFHLVGLLHDLGKV
Template Known Secondary structure 
...............STT
....TTGGG
Template Predicted Secondary structure  ...............



....
Template SS confidence 





















































   94.....100....... ..110... ......120........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions