Return to main results Retrieve Phyre Job Id

Job DescriptionP38036
Confidence89.93%DateThu Jan 5 11:57:49 GMT 2012
Rank400Aligned Residues35
% Identity29%Templatec3gw7A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:uncharacterized protein yedj; PDBTitle: crystal structure of a metal-dependent phosphohydrolase2 with conserved hd domain (yedj) from escherichia coli in3 complex with nickel ions. northeast structural genomics4 consortium target er63
Resolution3.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   30.........40.........50.........60.........70.........
Predicted Secondary structure 










Query SS confidence 

















































Query Sequence  HCLDVAAVADCWWDQSVVLQNTFCRNEMLSKQRVKAWLLFFIALHDIGKF
Query Conservation 

 


  
  
                             
 


 

 
Alig confidence 









...........









....














Template Conservation 
  

  

 ........... 

  
 

 .... 

  







  
Template Sequence  HFRRVWATAQ. . . . . . . . . . . KLAADDDVDM. . . . LVILTACYFHDIVSQ
Template Known Secondary structure  ...........TTTS
S
T....TTTTT

Template Predicted Secondary structure  ...........



....


Template SS confidence 

















































   2930........ .40........ .50.........60...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions